BioActiveTM Recombinant Mouse GM-CSF Protein

Catalog Number

SG1855G
Source
Human Embryonic Kidney 293 cell expressed mouse GM-CSF protein
Ala17-Lys141
Accession

P01587

Request Quote
First Name *
Last Name *
Email Address *
Instiution *
Prodcuts/Services *
Questions & Comments *
Download
BioActiveTM Recombinant Mouse GM-CSF Protein

BioActiveTM Recombinant Mouse GM-CSF Protein
Catalog Number

SG1855G
Source
Human Embryonic Kidney 293 cell expressed mouse GM-CSF protein
Ala17-Lys141
Accession

P01587

Alternativenames

Colony stimulatingfactor

Colony StimulatingFactor 2

Colony stimulatingfactor 2 (granulocyte-macrophage)

Colony-stimulatingfactor

CSF

CSF 2

CSF2

CSF2_HUMAN

GM-CSF

GMCSF

GranulocyteMacrophage Colony Stimulating Factor

Granulocyte-macrophagecolony-stimulating factor

MGC131935

MGC138897

MGI1GM

Molgramostin

Pluripoietin-a

Sargramostim

Biological activity

Fullybiologically active

Purity

>95% by SDS-PAGE & HPLC

Endotoxin level

<5 EU/MG

Expression system

HEK293 Cells

Format

Recombinant

Species

Human

Sequence

APTRSPITVTRPWKHVEAIKEALNLLDDMPVTLNEEVEVVSNEFSFKKLTCVQTRLKIFEQGLRGNFTKLKGALNMTASY

YQTYCPPTPETDCETQVTTYADFIDSLKTFLTDIPFECKKPVQK

Predicted MW

14kDa

Actual MW

14kDa

Applications

Cell Culture

SDS-PAGE

HPLC

MassSpectrometry

FunctionalStudies

Form

Lyophilized

Concentration

N/A

Stability andStorage

Shipped at Room Temperature. Store at RoomTemperature.

Reconstitution

Reconstitute withPhosphate Buffered Saline.

BioActiveTM Recombinant Mouse GM-CSF Protein
Catalog Number

SG1855G
Source
Human Embryonic Kidney 293 cell expressed mouse GM-CSF protein
Ala17-Lys141
Accession

P01587

Alternativenames

Colony stimulatingfactor

Colony StimulatingFactor 2

Colony stimulatingfactor 2 (granulocyte-macrophage)

Colony-stimulatingfactor

CSF

CSF 2

CSF2

CSF2_HUMAN

GM-CSF

GMCSF

GranulocyteMacrophage Colony Stimulating Factor

Granulocyte-macrophagecolony-stimulating factor

MGC131935

MGC138897

MGI1GM

Molgramostin

Pluripoietin-a

Sargramostim

Biological activity

Fullybiologically active

Purity

>95% by SDS-PAGE & HPLC

Endotoxin level

<5 EU/MG

Expression system

HEK293 Cells

Format

Recombinant

Species

Human

Sequence

APTRSPITVTRPWKHVEAIKEALNLLDDMPVTLNEEVEVVSNEFSFKKLTCVQTRLKIFEQGLRGNFTKLKGALNMTASY

YQTYCPPTPETDCETQVTTYADFIDSLKTFLTDIPFECKKPVQK

Predicted MW

14kDa

Actual MW

14kDa

Applications

Cell Culture

SDS-PAGE

HPLC

MassSpectrometry

FunctionalStudies

Form

Lyophilized

Concentration

N/A

Stability andStorage

Shipped at Room Temperature. Store at RoomTemperature.

Reconstitution

Reconstitute withPhosphate Buffered Saline.