BioActiveTM Recombinant Mouse IL-2 Protein

Catalog Number

SG1852I
Source
Human Embryonic Kidney 293 cell expressed Mouse IL-2 protein
Ala21-Gln169
Accession

P04351

Request Quote
First Name *
Last Name *
Email Address *
Instiution *
Prodcuts/Services *
Questions & Comments *
Download
BioActiveTM Recombinant Mouse IL-2 Protein

BioActiveTM Recombinant Mouse IL-2 Protein
Catalog Number

SG1852I
Source
Human Embryonic Kidney 293 cell expressed Mouse IL-2 protein
Ala21-Gln169
Accession

P04351

Alternativenames

Aldesleukin

IL 2

IL-2

IL2

IL2_HUMAN

Interleukin 2

Interleukin-2

interleukin2

Involved inregulation of T cell clonal expansion

Lymphokine

OTTHUMP00000164090

POIL2

T Cell GrowthFactor

T-cell growthfactor

TCGF

Biological activity

Fullybiologically active

Purity

>95% by SDS-PAGE & HPLC

Endotoxin level

<5 EU/MG

Expression system

HEK293 Cells

Format

Recombinant

Species

Human

Sequence

APTSSSTSSSTAEAQQQQQQQQQQQQHLEQLLMDLQELLSRMENYRNLKLPRMLTFKFYLPKQATELKDLQCLEDEL

GPLRHVLDLTQSKSFQLEDAENFISNIRVTVVKLKGSDNTFECQFDDESATVVDFLRRWIAFCQSIISTSPQ

Predicted MW

17kDa

Actual MW

17kDa

Applications

Cell Culture

SDS-PAGE

HPLC

FunctionalStudies

Form

Lyophilized

Concentration

N/A

Stability andStorage

Shipped at Room Temperature. Store at RoomTemperature.

Reconstitution

Reconstitute withPhosphate Buffered Saline.

BioActiveTM Recombinant Mouse IL-2 Protein
Catalog Number

SG1852I
Source
Human Embryonic Kidney 293 cell expressed Mouse IL-2 protein
Ala21-Gln169
Accession

P04351

Alternativenames

Aldesleukin

IL 2

IL-2

IL2

IL2_HUMAN

Interleukin 2

Interleukin-2

interleukin2

Involved inregulation of T cell clonal expansion

Lymphokine

OTTHUMP00000164090

POIL2

T Cell GrowthFactor

T-cell growthfactor

TCGF

Biological activity

Fullybiologically active

Purity

>95% by SDS-PAGE & HPLC

Endotoxin level

<5 EU/MG

Expression system

HEK293 Cells

Format

Recombinant

Species

Human

Sequence

APTSSSTSSSTAEAQQQQQQQQQQQQHLEQLLMDLQELLSRMENYRNLKLPRMLTFKFYLPKQATELKDLQCLEDEL

GPLRHVLDLTQSKSFQLEDAENFISNIRVTVVKLKGSDNTFECQFDDESATVVDFLRRWIAFCQSIISTSPQ

Predicted MW

17kDa

Actual MW

17kDa

Applications

Cell Culture

SDS-PAGE

HPLC

FunctionalStudies

Form

Lyophilized

Concentration

N/A

Stability andStorage

Shipped at Room Temperature. Store at RoomTemperature.

Reconstitution

Reconstitute withPhosphate Buffered Saline.