BioActiveTM Recombinant Human M-CSF Protein

Catalog Number

SG1850M
Source
Human Embryonic Kidney 293 cell expressed human M-CSF protein
Glu33-Asn190
Accession

P02649

Request Quote
First Name *
Last Name *
Email Address *
Instiution *
Prodcuts/Services *
Questions & Comments *
Download
BioActiveTM Recombinant Human M-CSF Protein

BioActiveTM Recombinant Human M-CSF Protein
Catalog Number

SG1850M
Source
Human Embryonic Kidney 293 cell expressed human M-CSF protein
Glu33-Asn190
Accession

P02649

Alternativenames

Colonystimulating factor 1

Colonystimulating factor 1 (macrophage)

Colonystimulating factor macrophage specific

CSF 1

CSF-1

CSF1

CSF1_HUMAN

Csfm

Lanimostim

M CSF

M-CSF

Macrophagecolony stimulating factor

MacrophageColony Stimulating Factor 1

MCSF

MGC31930

Processedmacrophage colony-stimulating factor 1

Biological activity

Fullybiologically active

Purity

>95% by SDS-PAGE & HPLC

Endotoxin level

<5 EU/MG

Expression system

HEK293 Cells

Format

Recombinant

Species

Human

Sequence

EEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQYIMEDTMRFRDNTPNAIAIVQL

QELSLRLKSCFTKDYEEHDKACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSSQD VVTKPDCN

Predicted MW

19kDa

Actual MW

19kDa

Applications

Functional Studies

SDS-PAGE

Mass Spectrometry

HPLC

Form

Lyophilized

Concentration

N/A

Stability andStorage

Shipped at Room Temperature. Store at RoomTemperature.

Reconstitution

Reconstitute withPhosphate Buffered Saline.

BioActiveTM Recombinant Human M-CSF Protein
Catalog Number

SG1850M
Source
Human Embryonic Kidney 293 cell expressed human M-CSF protein
Glu33-Asn190
Accession

P02649

Alternativenames

Colonystimulating factor 1

Colonystimulating factor 1 (macrophage)

Colonystimulating factor macrophage specific

CSF 1

CSF-1

CSF1

CSF1_HUMAN

Csfm

Lanimostim

M CSF

M-CSF

Macrophagecolony stimulating factor

MacrophageColony Stimulating Factor 1

MCSF

MGC31930

Processedmacrophage colony-stimulating factor 1

Biological activity

Fullybiologically active

Purity

>95% by SDS-PAGE & HPLC

Endotoxin level

<5 EU/MG

Expression system

HEK293 Cells

Format

Recombinant

Species

Human

Sequence

EEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQYIMEDTMRFRDNTPNAIAIVQL

QELSLRLKSCFTKDYEEHDKACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSSQD VVTKPDCN

Predicted MW

19kDa

Actual MW

19kDa

Applications

Functional Studies

SDS-PAGE

Mass Spectrometry

HPLC

Form

Lyophilized

Concentration

N/A

Stability andStorage

Shipped at Room Temperature. Store at RoomTemperature.

Reconstitution

Reconstitute withPhosphate Buffered Saline.