BioActiveTM Recombinant Human EGF Protein

Catalog Number

SG1846E
Source
Human Embryonic Kidney 293 cell expressed human EGF protein
Asn971-Arg1023
Accession

P01133

Request Quote
First Name *
Last Name *
Email Address *
Instiution *
Prodcuts/Services *
Questions & Comments *
Download
BioActiveTM Recombinant Human EGF Protein

BioActiveTM Recombinant Human EGF Protein
Catalog Number

SG1846E
Source
Human Embryonic Kidney 293 cell expressed human EGF protein
Asn971-Arg1023
Accession

P01133

Alternativenames

Betaurogastrone

beta-urogastrone

EGF

EGF_HUMAN

Epidermalgrowth factor

HOMG4

OTTHUMP00000219721

OTTHUMP00000219722

Pro epidermalgrowth factor

URG

Urogastrone

Biological activity

Fullybiologically active

Purity

>95% by SDS-PAGE & HPLC

Endotoxin level

<5 EU/MG

Expression system

HEK293 Cells

Format

Recombinant

Species

Human

Sequence

NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR

Predicted MW

6kDa

Actual MW

6kDa

Applications

CellCulture

SandwichELISA

FunctionalStudies

MassSpectrometry

SDS-PAGE

HPLC

Form

Lyophilized

Concentration

N/A

Stability andStorage

Shipped at Room Temperature. Store at RoomTemperature.

Reconstitution

Reconstitute withPhosphate Buffered Saline.

BioActiveTM Recombinant Human EGF Protein
Catalog Number

SG1846E
Source
Human Embryonic Kidney 293 cell expressed human EGF protein
Asn971-Arg1023
Accession

P01133

Alternativenames

Betaurogastrone

beta-urogastrone

EGF

EGF_HUMAN

Epidermalgrowth factor

HOMG4

OTTHUMP00000219721

OTTHUMP00000219722

Pro epidermalgrowth factor

URG

Urogastrone

Biological activity

Fullybiologically active

Purity

>95% by SDS-PAGE & HPLC

Endotoxin level

<5 EU/MG

Expression system

HEK293 Cells

Format

Recombinant

Species

Human

Sequence

NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR

Predicted MW

6kDa

Actual MW

6kDa

Applications

CellCulture

SandwichELISA

FunctionalStudies

MassSpectrometry

SDS-PAGE

HPLC

Form

Lyophilized

Concentration

N/A

Stability andStorage

Shipped at Room Temperature. Store at RoomTemperature.

Reconstitution

Reconstitute withPhosphate Buffered Saline.