BioActiveTM Recombinant Human Interferon gamma Protein

Catalog Number

SG1844I
Source
Human Embryonic Kidney 293 cell expressed human Interferon gamma protein
Asn24-Asn166
Accession

P01579

Request Quote
First Name *
Last Name *
Email Address *
Instiution *
Prodcuts/Services *
Questions & Comments *
Download
BioActiveTM Recombinant Human Interferon gamma Protein

BioActiveTM Recombinant Human Interferon gamma Protein
Catalog Number

SG1844I
Source
Human Embryonic Kidney 293 cell expressed human Interferon gamma protein
Asn24-Asn166
Accession

P01579

Alternative names

IF 1

IFG

IFI

ifn g

IFN gamma

IFN immune

IFN, immune

IFN-gamma

IFNG

IFNG_HUMAN

Immuneinterferon

Interferongamma

Type IIInterferon

Biological activity

Fullybiologically active

Purity

>95% by SDS-PAGE & HPLC

Endotoxin level

<5 EU/MG

Expression system

HEK293 Cells

Format

Recombinant

Species

Human

Sequence

QDPYVQEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNV

KFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ

Predicted MW

17kDa

Actual MW

17kDa

Additional sequenceinformation

Fulllength protein including propeptide. N-terminal Glycine

Applications

Mass Spectrometry

Cell Culture

HPLC

SDS-PAGE

Functional Studies

Form

Lyophilized

Concentration

N/A

Stability andStorage

Shipped at Room Temperature. Store at RoomTemperature.

Reconstitution

Reconstitute withPhosphate Buffered Saline.

BioActiveTM Recombinant Human Interferon gamma Protein
Catalog Number

SG1844I
Source
Human Embryonic Kidney 293 cell expressed human Interferon gamma protein
Asn24-Asn166
Accession

P01579

Alternative names

IF 1

IFG

IFI

ifn g

IFN gamma

IFN immune

IFN, immune

IFN-gamma

IFNG

IFNG_HUMAN

Immuneinterferon

Interferongamma

Type IIInterferon

Biological activity

Fullybiologically active

Purity

>95% by SDS-PAGE & HPLC

Endotoxin level

<5 EU/MG

Expression system

HEK293 Cells

Format

Recombinant

Species

Human

Sequence

QDPYVQEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNV

KFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ

Predicted MW

17kDa

Actual MW

17kDa

Additional sequenceinformation

Fulllength protein including propeptide. N-terminal Glycine

Applications

Mass Spectrometry

Cell Culture

HPLC

SDS-PAGE

Functional Studies

Form

Lyophilized

Concentration

N/A

Stability andStorage

Shipped at Room Temperature. Store at RoomTemperature.

Reconstitution

Reconstitute withPhosphate Buffered Saline.