BioActiveTM Recombinant Human IL-6 Protein

Catalog Number

SG1845I
Source
Human Embryonic Kidney 293 cell expressed human IL-6 protein
Ala28-Met212
Accession

P05231

Request Quote
First Name *
Last Name *
Email Address *
Instiution *
Prodcuts/Services *
Questions & Comments *
Download
BioActiveTM Recombinant Human IL-6 Protein

BioActiveTM Recombinant Human IL-6 Protein
Catalog Number

SG1845I
Source
Human Embryonic Kidney 293 cell expressed human IL-6 protein
Ala28-Met212
Accession

P05231

Alternativenames

InterleukinBSF 2

Bcell differentiation factor

Bcell stimulatory factor 2

B-cellstimulatory factor 2

BSF2

BSF-2

BSF2

CDF

CTLdifferentiation factor

CytotoxicT cell differentiation factor

Hepatocytestimulating factor

Hepatocytestimulatory factor

HGF

HSF

Hybridomagrowth factor

Hybridomagrowth factor Interferon beta-2

Hybridomaplasmacytoma growth factor

IFN-beta-2

IFNB2

IL6

IL-6

IL6

IL6_HUMAN

Interferonbeta 2

Interferonbeta-2

Interleukin6

Interleukin6 (interferon beta 2)

InterleukinBSF 2

Interleukin-6

Biological activity

Fullybiologically active

Purity

>95% by SDS-PAGE & HPLC

Endotoxin level

<5 EU/MG

Expression system

HEK293 Cells

Format

Recombinant

Species

Human

Sequence

APVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFN

EETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQD

MTTHLILRSFKEFLQSSLRALRQM

Predicted MW

21kDa

Actual MW

21kDa

Applications

CellCulture

SandwichELISA

FunctionalStudies

MassSpectrometry

SDS-PAGE

HPLC

Form

Lyophilized

Concentration

N/A

Stability andStorage

Shipped at Room Temperature. Store at RoomTemperature.

Reconstitution

Reconstitute withPhosphate Buffered Saline.

BioActiveTM Recombinant Human IL-6 Protein
Catalog Number

SG1845I
Source
Human Embryonic Kidney 293 cell expressed human IL-6 protein
Ala28-Met212
Accession

P05231

Alternativenames

InterleukinBSF 2

Bcell differentiation factor

Bcell stimulatory factor 2

B-cellstimulatory factor 2

BSF2

BSF-2

BSF2

CDF

CTLdifferentiation factor

CytotoxicT cell differentiation factor

Hepatocytestimulating factor

Hepatocytestimulatory factor

HGF

HSF

Hybridomagrowth factor

Hybridomagrowth factor Interferon beta-2

Hybridomaplasmacytoma growth factor

IFN-beta-2

IFNB2

IL6

IL-6

IL6

IL6_HUMAN

Interferonbeta 2

Interferonbeta-2

Interleukin6

Interleukin6 (interferon beta 2)

InterleukinBSF 2

Interleukin-6

Biological activity

Fullybiologically active

Purity

>95% by SDS-PAGE & HPLC

Endotoxin level

<5 EU/MG

Expression system

HEK293 Cells

Format

Recombinant

Species

Human

Sequence

APVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFN

EETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQD

MTTHLILRSFKEFLQSSLRALRQM

Predicted MW

21kDa

Actual MW

21kDa

Applications

CellCulture

SandwichELISA

FunctionalStudies

MassSpectrometry

SDS-PAGE

HPLC

Form

Lyophilized

Concentration

N/A

Stability andStorage

Shipped at Room Temperature. Store at RoomTemperature.

Reconstitution

Reconstitute withPhosphate Buffered Saline.